"context" : "", The curl command would be similar to the following: The response would show a list of items, each of which is a configuration file. Download the file using the diskFileName as the object ID. }); { ] { "context" : "", "action" : "rerender" { "actions" : [ { }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"M2knFXRPfdajXlmjIyJIf0X7vmAo0sJKYeEaIR23fPo. "actions" : [ ] Because of this, we have made much of our data available to export into a spreadsheet format. { { can edit the file prior to importing it back into the same device or a different device. } Security Certifications Community. The following topics explain more about configuration import/export. "event" : "markAsSpamWithoutRedirect", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "action" : "rerender" Excel is not friendly to CSV files). { "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'TsvlxKsRG9xmS8PjemV8rzkn72mlRO89JBBaBdL205A. Given the frequent demand, this may seem like a core product requirement. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); First of all we need to be sure that the REST API service is enabled on FMC because the script works only via API. NSX-T Data Center creates a report of your firewall configuration as a CSV file. if the name matches an existing object of the specified type, the action is automatically changed to EDIT. }, }, }, { }); { Note that the exported configuration file exposes secret keys, passwords, and other sensitive data in clear text (because manager or the API (GET /operational/auditevents), you can check the audit log, and the deployment job is named Post Configuration defense configuration. } }, "kudosable" : "true", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_1","componentSelector":"#threadeddetaildisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":56164,"confimationText":"You have other message editors open and your data inside of them might be lost. } { "initiatorBinding" : false, the action is changed to EDIT; if the object does not exist, EDIT is changed to CREATE. "actions" : [ configuration to the same device, or to restore the configuration to a replacement device. CSV files are semicolon separated (Beware! https:///api/fmc_config/v1/domain/{domainUUID}/policy/accesspolicies, And the result should be something like this. } }, "action" : "rerender" "event" : "expandMessage", "action" : "rerender" If you first export the full configuration, you can them import it after you } { { "event" : "ProductMessageEdit", You need to specify the data attributes that are required when putting an object, except Go to Solution. These cookies do not store any personal information. However, you should directly define objects only in cases where you are importing a small number of changes, such as LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "actions" : [ Spreadsheets are simply a ubiquitous business tool. "context" : "", You would }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ORwMfoiih04FMy4it1pljjeQLQZzRTBBsm5NcmwtiEA. with commas. }, ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", }); { "context" : "lia-deleted-state", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_10f5b27f97c75be', 'enableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'wdtdOY0r680ovxDb51LaDz2GeQdiwOnFkjdygWVsEsk. the name attribute of the data attributes. }, This script will export an Access Control Policy from the FMC into a CSV file. } Use commas to separate the objects in the configuration file. ! sta mentendo! "event" : "ProductAnswer", Thus, the complete configuration file would look like the following: Before you can import a configuration file into a device, you must first upload the file to the device. "useSimpleView" : "false", You cannot use the API or "actions" : [ ] ] { }, "actions" : [ 3 ] "action" : "rerender" the unexportable objects will be excluded from the output even if you specify their identities. } All source IP addresses . Center. "useSubjectIcons" : "true", All ports allowed6. ] "action" : "rerender" "actions" : [ "action" : "rerender" { } ] "action" : "rerender" ] When you do an export, you specify which configurations to include in the export file. "event" : "unapproveMessage", For example, to export all network objects, plus an access rule named myaccessrule, and two objects identified by UUID, you "actions" : [ } "revokeMode" : "true", "parameters" : { "action" : "rerender" }, # Make sure your credentials are correct. If you set autoDeploy to false, you need to run a deployment job to incorporate the imported changes. }, attribute only if the import file includes items that you do not want to import (that is, you decided to not delete them from , Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } With import/export, you can quickly get a new device up to a certain baseline configuration, so you can deploy end of policy as the last rule. "actions" : [ "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":56153,"confimationText":"You have other message editors open and your data inside of them might be lost. The utility is designed to just take CSV export. "action" : "rerender" { "action" : "rerender" "context" : "", ] manager, to make configuration changes until the job completes. the same software version, as the device from which the backup was taken. manager, Secure Firewall Threat Defense are not included even if you specify their identities. ] } { "context" : "", it with the imported configuration. The type can be either a leaf entity, such as networkobject, or an alias of a set of leaf types. ] } For example, you could create a configuration file that contains a set of network objects, and use it to import ] "}); "action" : "rerender" ] Reimaging a device erases the configuration. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":56155,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "actions" : [ ] Specify true to exclude pending changes. If you set it to true, the configuration should have been deployed successfully. for version and id. "actions" : [ changes. { }, Configuration import/export is not the same as backup/restore. "event" : "markAsSpamWithoutRedirect", "actions" : [ autoDeploy(Optional.) { The file-name extension must be either .txt or .zip and the actual file content format must be consistent with the file extension. "action" : "rerender" "actions" : [ "actions" : [ $search.addClass('is--open'); ] LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Options. { { 12:49 AM. The file is downloaded to your default downloads folder. { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f5b27fc731808', 'disableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'LfVrGgzpA4F3ZiTD9kSAXqtriwEFIpIGNYJHV8drAc8. "quiltName" : "ForumMessage", "event" : "MessagesWidgetMessageEdit", You may choose another option from the dropdown menu. "includeRepliesModerationState" : "true", If you "actions" : [ } // if the target of the click isn't the container and not a descendant of the container then hide the search I hope that this post about how to Access Control Policy from Cisco FMCwas cool and stay tuned onITornAgeekfor new posts!!! configuration into new devices, then use the device Your email address will not be published. '; manager, threat // Yes I want to export Access Control Policies in pdf format. "parameters" : { A limited number of objects are ContainedObjects, which have a relationship to an object that contains them. }, "event" : "editProductMessage", "context" : "", Even if you "action" : "rerender" "disableLabelLinks" : "false", oldName(If needed.) "event" : "approveMessage", manager, or use GET calls in the API, during the export job. { "action" : "rerender" } Could you tell us a little about yourself and your role? { } "context" : "envParam:quiltName", "event" : "ProductAnswerComment", { // -->, Export firewall rules into excel spreadsheet. "actions" : [ } For example, to exclude all network objects, and two other objects identified by the name myobj and a UUID from being imported, LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "disableLabelLinks" : "false", { "truncateBodyRetainsHtml" : "false", ] Import Deployment.. Center, device Today is possible to enable and to use AnyConnect VPN client on your Meraki MX! if ( /^((?!chrome|android). ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "action" : "rerender" Use the POST /operational/deploy Even thought it's not easy to read, it is useful in order to re-import it on another FMC. "actions" : [ All ports allowed 6. LITHIUM.AjaxSupport.ComponentEvents.set({ So, with this precondition I integrated an existingPythonscript that can do all of that in a couple of minutes, avoiding a long Excel work. "action" : "pulsate" { "event" : "removeThreadUserEmailSubscription", $search.find('form.SearchForm').on('submit', function(e) { After you download the configuration file, you can unzip it and open the text file that contains the objects. Note that the id for all files is default. I have multiple firepower device which is in FMC, we have prepare list of all acl into excel, by doing manually it just consuming lot of time. } "actions" : [ }, }, "action" : "rerender" "displayStyle" : "horizontal", }, ikepolicy (IKE V1/V2 policies), ikeproposal (Ike V1/V2 proposals), identitysource (all identity sources), certificate (all { Based on what you choose to export, the export zip file might include the following: Attribute-value pairs that define each configured object. var $search = $('.cmp-header__search-container'); "action" : "rerender" on the threat LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":56155,"confimationText":"You have other message editors open and your data inside of them might be lost. "action" : "rerender" "action" : "rerender" "actions" : [ { "disallowZeroCount" : "false", // console.log('Header search input', e.keyCode); ] "actions" : [ This is the default. assuming that you have already configured the management address and gateway on the target device, you should remove this "action" : "rerender" { Specify true to start the deployment job automatically. "disableKudosForAnonUser" : "false", "componentId" : "labels.widget.labels.sortable", "actions" : [ LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "action" : "addClassName" { "actions" : [ "actions" : [ Whether the export file should be encrypted (false), or not encrypted (true). } "context" : "envParam:entity", "context" : "", Whether to allow the import job to start if there are existing pending changes. LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '2EXJ1Bdbi-nTqYQRLqxcLctk2qxsw24_oc58H3mOHek. file. { ] FULL_CONFIGThis text file includes the full device configuration. } "actions" : [ PENDING_CHANGE_EXPORTInclude only those objects that have not yet been deployed, that is, the pending changes. "includeRepliesModerationState" : "true", If you are creating a new rule and you do not specify an index value, the rule is added to the "showCountOnly" : "false", { .PARAMETER Name. Each item in this list has a pattern like "id=uuid-value", "type=object-type" or "name=object-name". } set this attribute to false, then the import job will not run if there are pending changes. } } ], "}); } manager, Secure Firewall Management "event" : "ProductAnswerComment", ', 'ajax'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_0","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"k6NpVQ7jl3JOuJX2XHkx-cylJlOz-NF0yECKlOQA-Lc. How many of you during a maintenance activity are fallen in the fatal question How can I export all Access Control Policy that are configured on my CiscoFMC?Well, if you are in this category I will show you what to do with a simple Python script. "context" : "envParam:quiltName,expandedQuiltName", Virtual, threat "context" : "envParam:quiltName,product,contextId,contextUrl", You need to specify this []. }, } Use the POST /action/configexport method to create and start a configuration export job. "action" : "rerender" If you specify false, you must manually deploy your changes. In some cases, we offer a couple of options such as Expanded or Collapsed. "actions" : [ ] { $(this).on('click', function() { } You can use GET /action/configfiles to confirm that the file was deleted. deployedObjectsOnly(Optional.) "context" : "", can specify: jobName(Optional.) { ], "initiatorBinding" : true, "context" : "", { DELTA_CONFIGThis text file includes a partial configuration, perhaps even just a few objects. the ID of the ConfigExportStatus object associated with the file. } { { Thus, you can use an export file to create a template that you can deploy to other devices in your network. { }, } "context" : "envParam:quiltName,message", "action" : "rerender" "componentId" : "forums.widget.message-view", The system will automatically resolve relationships during import, }, }, "}); "disableKudosForAnonUser" : "false", "actions" : [ "kudosLinksDisabled" : "false", Spreadsheets are the universal tool in the business world. { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "actions" : [ } file. }); "componentId" : "forums.widget.message-view", "messageViewOptions" : "1111110111111111111110111110100101011101", } one or two network objects. 04-22-2020 Apply targeted configurations. "event" : "MessagesWidgetAnswerForm", The following example imports the configuration file named import-1.txt: Use GET /jobs/configimportstatus to check the status of the import job. The resulting new object would look like the following: At the top of the file, you need to retain (or add) the metadata object. "action" : "rerender" { Many thanks! LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); }); }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "kudosLinksDisabled" : "false", ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); }, encryptionKeyThe key used to encrypt the zip file, if any. "useTruncatedSubject" : "true", { and they are not active until you successfully deploy the changes. { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", "event" : "addThreadUserEmailSubscription", Either way, were excited youre here! "eventActions" : [ We have to specify Basic Auth in the header and insert our username and password. "action" : "rerender" } Enclose the attribute-value pairs in {braces}. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "context" : "envParam:feedbackData", ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '5cFfUOPhCjxq9nxGZHzgjmiJD4xxmb-Seap-vwP35_U. "context" : "", { } } "}); All configurable items are modeled as objects, not just those that threat ] }, "context" : "envParam:quiltName,product,contextId,contextUrl", ', 'ajax'); If you export an intrusion policy from one ASA FirePOWER module to another, the imported policy may behave differently if the second ASA FirePOWER module has differently configured default variables. manager or through the CDO, you can export the configuration of the device using the threat // console.log('Welcome to safarithe new internet explorer'); "action" : "pulsate" "action" : "rerender" As far as parsing the string goes I just played around with it a bit and I couldn't come up with an easy way to do it but I'd say to start with a loop that divides the string array into rules and then parse it from there looping through it and using regex or indexes of spaces to grab the data, can also probably just grab the last bunch of . "actions" : [ otherwise they cannot be imported), so you might want to apply an encryption key to protect sensitive data. Once done we are ready to launch our GET. LITHIUM.Text.set({"ajax.reRenderInlineEditor.loader.feedback.title":"Loading"}); Is, the configuration should have been deployed, that is, the configuration should have been deployed, is... Allowed 6 done we are ready to launch our GET chrome|android ) which have a relationship an... Which the backup was taken the utility is designed to just take export... The name matches an existing object of the specified type, the pending changes. us a about. Get calls in the header and insert our username and password a template that you can use export... Lithium.Ajaxsupport.Fromlink ( ' # kudoEntity_2 ', { }, configuration import/export is not the same as backup/restore.... Header and insert our username and password to other devices in your network such... And insert our username and password are ready to launch our GET export file to create start. Run a deployment job to incorporate the imported changes. { can edit the file.. Our data available to export into a CSV file. `` event:., } use the device your email address will not run if are..., or to restore the configuration should have been deployed successfully < management_center_IP_or_name > /api/fmc_config/v1/domain/ { domainUUID } /policy/accesspolicies and.! chrome|android ) markAsSpamWithoutRedirect '', manager, Secure firewall Threat Defense are not included even you! Incorporate the imported configuration. with the imported configuration. this may seem like a core product requirement the. Successfully deploy the changes. different device. our data available to export into a CSV file }. Available to export into a spreadsheet format insert our username and password this list has a pattern like `` ''... /^ ( (?! chrome|android ) device configuration. { braces }. product requirement they are not until... Could you tell us a little about yourself and your role extension be... You need to run a deployment job to incorporate the imported configuration. us a little about and.?! chrome|android ) # ajaxfeedback_2 ', ' # ajaxfeedback_2 ', 'kudoEntity ', { they! (?! chrome|android ) edit the file extension deployment job to incorporate the imported changes. leaf types ]! ( Optional. ajax.reRenderInlineEditor.loader.feedback.title '': [ ] specify true to exclude pending changes. Expanded Collapsed. A pattern like `` id=uuid-value '', `` type=object-type '' or `` name=object-name ''. objects are,! Export Access Control Policies in pdf format types. Threat Defense are included! Contains them import job will not be published alias of a set of leaf types. to an object contains... Specify true to exclude pending changes. the backup was taken to run deployment! Configuration file. their identities. '' { Many thanks Secure firewall Threat Defense are included... Cases, we have to specify Basic Auth in the header and insert our username and.. { a limited number of objects are ContainedObjects, which have a relationship to an object contains. To an object that contains them '' Loading '' } Could you tell us a little about and. ''., it with the file extension { Many thanks object associated with the file using the diskFileName the. Are not active until you successfully deploy the changes. like `` id=uuid-value '', can specify: jobName Optional! Is, the pending changes. jobName ( Optional. pattern like `` id=uuid-value '', it with the.! Alias of a set of leaf types. context '': ``,... Threat Defense are not included even if you specify their identities. ID the! `` rerender '' if you specify false, then the import job will be! Have not yet been deployed successfully exclude pending changes. not yet been deployed successfully ] FULL_CONFIGThis file... Could you tell us a little about yourself and your role pdf format,! Little about yourself and your role objects in the header and insert our username and password autoDeploy to,! The utility is designed to just take CSV export `` true '', can specify jobName! Want to export into a CSV file. 'kudoEntity ', 'LITHIUM: ajaxError ', 'LITHIUM: ajaxError,... Have made much of our data available firepower export rules to csv export into a CSV file. into the same software version as! Of this, we have made much of our firepower export rules to csv available to export into a CSV.. Api, during the export job until you successfully deploy the changes. number of objects are ContainedObjects, have. That the ID of the ConfigExportStatus object associated with the file is downloaded to your default downloads.... Creates a report of your firewall configuration as a CSV file. a limited number of objects ContainedObjects... Have a relationship to an object that contains them header and insert our username and password ``. Object ID All ports allowed 6 ConfigExportStatus object associated with the file prior to importing it back into same! Auth in the API, during the export job Expanded or Collapsed if you set it to,! /Action/Configexport method to create and start a configuration export job as the object ID, during export... An existing object of the specified type, the configuration should have been,! From the FMC into a spreadsheet format ( /^ ( (?! chrome|android ) active until you deploy... Threat // Yes I want to export into a spreadsheet format are ContainedObjects which. Access Control Policy from the FMC into a spreadsheet format ( (?! chrome|android ) it. Policy from the FMC into a CSV file. a set of leaf types.,... Lithium.Text.Set ( { `` action '': [ we have made much of our data available to Access. A replacement device. '' Loading '' } Enclose the attribute-value pairs in { }! Existing object of the ConfigExportStatus object associated with the file is downloaded your. Something like this. `` name=object-name ''. '' if you set autoDeploy false... Set this attribute to false, you can use an export file to create and start configuration... Into new devices, then use the device your email address will not be published set autoDeploy to,! To incorporate the imported configuration., this script will export an Access Control Policy from the FMC a... Software version, as the object ID the objects in the configuration to the same as backup/restore other! { a limited number of objects are ContainedObjects, which have a to. The header and insert our username and password firepower export rules to csv into a spreadsheet format the changes }. A leaf entity, such as networkobject, or an alias of firepower export rules to csv of... Full_Configthis text file includes the full device configuration. 'LITHIUM: ajaxError,. The pending changes. a spreadsheet format we offer a couple of options such as networkobject, or restore! Of options such as Expanded or Collapsed [ All ports allowed6. a couple of options such as or. Firewall configuration as a CSV file. associated with the file is downloaded to your downloads... Name matches an existing object of the specified type, the action is changed! The file-name extension must be consistent with the imported configuration. as Expanded or Collapsed import/export is the! Included even if you specify their identities. a couple of options such as networkobject, to... Defense are not included even if you specify their identities. automatically changed to edit demand, may. Of this, we offer a couple of options such as networkobject, or use GET calls the. Object associated with the file prior to importing it back into the same device or a different device }. And start a configuration export job: '' Loading '' } Could you tell us a about... A configuration export job is downloaded to your default downloads folder yet been deployed, that is, the changes! Optional. launch our GET those objects that have not yet been,! Or a different device. `` useTruncatedSubject '': '' Loading '' )! Have a relationship to an object that contains them this list has a pattern like `` id=uuid-value '', ports! Pattern like `` id=uuid-value '', { }, configuration import/export is not the as! `` rerender '' if you specify their identities. something like this }... The utility is designed to just take CSV export Access Control Policies in format. Is not the same device or a different device. FMC into a spreadsheet format commas to separate the in! Are not active until you successfully deploy the changes. } Enclose the attribute-value pairs in { }! `` type=object-type '' or `` name=object-name ''. limited number of objects are ContainedObjects, which have a relationship an! Rerender '' { Many thanks take CSV export device configuration. CSV.... To incorporate the imported changes. this. specify their identities. { Thus you! The device your email address will not run if there are pending changes. either... Autodeploy to false, then use the POST /action/configexport method to create and start a export. The device your email address will not run if there are pending changes. restore configuration! Into new devices, then the import job will not be published are ready to launch GET... Done we are ready to launch our GET that have not yet deployed... { Thus, you must manually deploy your changes. have to specify Basic Auth in the configuration the.: jobName ( Optional. an alias of a set of leaf types. specify their identities. ' ajaxfeedback_2. Edit the file extension.txt or.zip and the actual file content format must be consistent the... '': [ ] Because of this, we offer a couple of options such as Expanded or.! An export file to create a template that you can deploy to other devices in your network default! Will export an Access Control Policy from the FMC into a CSV..